22 Top Cheap Breast Forms

11 Feb 2019

Waterdrop Silicone Breast Forms Lifelike Boobs Non Allergic Medical Silicone For Mastectomy Prosthesis 2 1600G 4XL Cupee 6 0 5 1 2 6Inch

Waterdrop Silicone Breast Forms Lifelike Boobs Non Allergic Medical Silicone For Mastectomy Prosthesis 2 1600G 4XL Cupee 6 0 5 1 2 6Inch
Waterdrop Silicone Breast Forms Lifelike Boobs Non Allergic Medical Silicone For Mastectomy Prosthesis 2 1600G 4XL Cupee 6 0 5 1 2 6Inch

Waterdrop Silicone Breast Forms Lifelike Boobs Non Allergic Medical Silicone For Mastectomy Prosthesis 2 1600G 4XL Cupee 6 0 5 1 2 6Inch. Material: 100% high quality hypoallergenic medical grade silicone Gel, touch very soft and feeling as same as real. It's also perfect for post op mastectomy and everybody else who wants an invisible support for a fabulous shape! waterdrop shape to match the curves of the chest cage giving perfect fit and comfort. A pair of full silicone breasts, designed as enhancers or prosthesis for women with flat chest (very small or no breasts). The silicone enhancers can perfectly boost breasts by 2 6 cups size. 1000 g / XL / 14 11.7 5.5 CM / Cup D / 5.5 4.7 2.2 inch 1200 g / 2 XL / 14.3 12.1 5.7 CM / Cup DD / 5.6 4.8 2.2 inch 1400 g / 3 XL / 14.7 12.6 6 CM / Cup E / 5.8 5.0 2.4 inch 1600 g / 4 XL / 15 13 6.5 CM / Cup EE / 6.0 5.1 2.6 inch 1800 g / 5 XL / 15.4 13.5 6.9 CM / Cup F / 6.1 5.3 2.7 inch 2000 g / 6 XL / 16 13.8 7.3 CM / Cup FF / 6.3 5.4 2.9 inch 2400 g / 7 XL / 17.4 15 7.8 CM / Cup G / 6.9 5.9 3.1 inch 2800 g / 8 XL / 20 17.3 9.5 CM / Cup GG / 7.9 6.9 3.7 inch.

Fake Boobs False Breasts For Crossdresser Cosplay Mastectomy Patientsilicone Breast Forms

Fake Boobs False Breasts For Crossdresser Cosplay Mastectomy Patientsilicone Breast Forms
Fake Boobs False Breasts For Crossdresser Cosplay Mastectomy Patientsilicone Breast Forms

Fake Boobs False Breasts For Crossdresser Cosplay Mastectomy Patientsilicone Breast Forms. Form enhancing product creates women's breasts to look fuller with more cleavage. Fake Breasts Allows You to Go Bra-less with Confidence, Nobody Knows It's Fake Boobs Except Yourself. Washable and Waterproof, Conjoined Silicone Breast Forms Boobs Feeling Like Real Human Breasts. Product Designed as enhancers or prosthesis for women with flat chest (very small or no breasts), It's also perfect for. Material: silicone.

1 Pair Silicone Breast Form Round Shaped Hypoallergenic Silicone Enhancers Crossdresser Transgender Mastectomy Cosplay Cup Size A HH 1 2000G 6XL Cupff 11 8 6 7 3 4Inch

1 Pair Silicone Breast Form Round Shaped Hypoallergenic Silicone Enhancers Crossdresser Transgender Mastectomy Cosplay Cup Size A HH 1 2000G 6XL Cupff 11 8 6 7 3 4Inch
1 Pair Silicone Breast Form Round Shaped Hypoallergenic Silicone Enhancers Crossdresser Transgender Mastectomy Cosplay Cup Size A HH 1 2000G 6XL Cupff 11 8 6 7 3 4Inch

1 Pair Silicone Breast Form Round Shaped Hypoallergenic Silicone Enhancers Crossdresser Transgender Mastectomy Cosplay Cup Size A HH 1 2000G 6XL Cupff 11 8 6 7 3 4Inch. Authentic Visual: The contour of silicone breast is perfectly round shaped edge which is gives you a ultra-smooth appearance and authentic visual effect. Widely Application: Designed as enhancers for women with flat chest or uneven cup size for a fabulous shape, and perfect suitable for crossdresser, transgender, mastectomy patients, Cosplay, custom or just for fun. Material: 100% high quality hypoallergenic medical grade silicone Gel, touch very soft and feeling as same as real. 500 g / S/ 20.5 11 4.5 cm / Cup A / 8.1 4.3 1.8 inch 600 g / M/ 21.2 12 5 cm / Cup B / 8.3 4.7 2.0 inch 800 g / L/ 22.5 13 5.5 cm / Cup C / 8.9 5.1 2.2 inch 1000 g / XL / 23.5 14.5 6 cm / Cup D / 9.3 5.7 2.4 inch 1200 g / 2 XL / 26 14.5 6.5 cm / Cup DD / 10.2 5.7 2.6 inch 1400 g / 3 XL / 26.5 15.5 7 cm / Cup E / 10.4 6.1 2.8 inch 1600 g / 4 XL / 27.5 16 7.8 cm / Cup EE / 10.8 6.3 3.1 inch 1800 g / 5 XL / 28.5 16.5 8.3 cm / Cup F / 11.2 6.5 3.3 inch 2000 g / 6 XL / 30 17 8.7 cm / Cup FF / 11.8 6.7 3.4 inch 2400 g / 7 XL / 32 18.5 9.2 cm / Cup G / 12.6 7.3 3.6 inch 2800 g / 8 XL / 34.7 19 9.5 cm / Cup GG / 13.7 7.5 3.7 inch 3200 g / 9 XL / 36.5 20 10 cm / Cup H / 14.4 7.9 3.9 inch 3600 g / 10 XL / 37 20.5 10.5 cm / Cup HH / 14.6 8.1 4.1 inch.

Silicone Breast Form False Boob Mastectomy Support Open Bra Transgender Crossdresser 1200G 2XL Cupdd 10 2 5 9 2 3Inch

Silicone Breast Form False Boob Mastectomy Support Open Bra Transgender Crossdresser 1200G 2XL Cupdd 10 2 5 9 2 3Inch
Silicone Breast Form False Boob Mastectomy Support Open Bra Transgender Crossdresser 1200G 2XL Cupdd 10 2 5 9 2 3Inch

Silicone Breast Form False Boob Mastectomy Support Open Bra Transgender Crossdresser 1200G 2XL Cupdd 10 2 5 9 2 3Inch. Silicone Breasts Ideal For Cross Dresser, Transgender, Cosplay, Mastectomy Etc, Can Perfectly Boost Breasts. Privacy: 1 pair Silicone false breasts, Put into a Protective box to protect privacy. This is a special purposely made bra, show the full silicone breast forms / prosthesis for a marvelous and wonderful real natural look. The bra is lace materials to hold the weight of the breast forms. Maintenance and washing is easy in warm water with mild soap. 500 g / S/ 22 13 4.5 CM / Cup A / 8.7 5.1 1.8 inch 600 g / M/ 23 13.5 5 CM / Cup B / 9.1 5.3 2.0 inch 800 g / L/ 24 14 5.2 CM / Cup C / 9.4 5.5 2.0 inch 1000 g / XL / 25 14.5 5.5 CM / Cup D / 9.8 5.7 2.2 inch 1200 g / 2 XL / 26 15 5.8 CM / Cup DD / 10.2 5.9 2.3 inch 1400 g / 3 XL / 27 15.5 6.1 CM / Cup E / 10.6 6.1 2.4 inch 1600 g / 4 XL / 28 16.5 6.4 CM / Cup EE / 11.0 6.5 2.5 inch 1800 g / 5 XL / 29 16.5 6.7 CM / Cup F / 11.4 6.5 2.6 inch 2000 g / 6 XL / 30 17 7 CM / Cup FF / 11.8 6.7 2.8 inch 2400 g / 7 XL / 31.5 18 8 CM / Cup G / 12.4 7.1 3.1 inch 2800 g / 8 XL / 33 19 9 CM / Cup GG / 13.0 7.5 3.5 inch 3200 g / 9 XL / 34.5 20 10 CM / Cup H / 13.6 7.9 3.9 inch.

MFGE8 Lactadherin Breast Epithelial Antigen BA46 HMFG MFGM Milk Fat Globule EGF Factor 8 MFG E8 SED1 Lactadherin Short Form Medin FITC 129608 FITC 100Ul

MFGE8 Lactadherin Breast Epithelial Antigen BA46 HMFG MFGM Milk Fat Globule EGF Factor 8 MFG E8 SED1 Lactadherin Short Form Medin FITC 129608 FITC 100Ul
MFGE8 Lactadherin Breast Epithelial Antigen BA46 HMFG MFGM Milk Fat Globule EGF Factor 8 MFG E8 SED1 Lactadherin Short Form Medin FITC 129608 FITC 100Ul

MFGE8 Lactadherin Breast Epithelial Antigen BA46 HMFG MFGM Milk Fat Globule EGF Factor 8 MFG E8 SED1 Lactadherin Short Form Medin FITC 129608 FITC 100Ul. Applications: Suitable for use in ELISA, Western Blot and Immunoprecipitation. Also binds to phosphatidylserine-enriched cell surfaces in a receptor-independent manner. Recognizes human MFGE 8. Plays an role in the maintenance of intestinal epithelial homeostasis and the promotion of mucosal healing. Recommended Dilution: Optimal dilutions to be determined by the researcher. Promotes VEGF-dependent neovascularization. Zona pellucida-binding protein which may play a role in gamete interaction. Contributes to phagocytic removal of apoptotic cells in many tissues. Supplied as a liquid in PBS, p H 7.2. No preservative added. Binds specifically to rotavirus and inhibits its replication. Other applications not tested. Purified by Protein A affinity chromatography. AA Sequence: YAGNHCETKCVEPLGMENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFD. Specific ligand for the alpha-v / beta-3 and alpha-v / beta-5 receptors.

Round Silicone Breast Forms Elastic Mesh Breathable Bra Set A EE Cup 1 Pair Breasts 1 Underwear 3XL Cupe 1400G 5 7 5 5 3 0Inch

Round Silicone Breast Forms Elastic Mesh Breathable Bra Set A EE Cup 1 Pair Breasts 1 Underwear 3XL Cupe 1400G 5 7 5 5 3 0Inch
Round Silicone Breast Forms Elastic Mesh Breathable Bra Set A EE Cup 1 Pair Breasts 1 Underwear 3XL Cupe 1400G 5 7 5 5 3 0Inch

Round Silicone Breast Forms Elastic Mesh Breathable Bra Set A EE Cup 1 Pair Breasts 1 Underwear 3XL Cupe 1400G 5 7 5 5 3 0Inch. Material: Comfortable elastic fabric, mesh breathable and sexy. Contains: 1 pair breasts, 1 underwear. Product Name: Round fake breast bra set, A-EE cup. S / 12.2 12 5 cm / Cup A / 500 g 4.8 4.7 2.0 inch M / 12.5 12.2 5.2 cm / Cup B / 600 g 4.9 4.8 2.05 inch L / 14 13.5 5.5 cm / Cup C / 800 g 5.5 5.3 2.2 inch XL / 14.2 14 6 cm / Cup D / 1000 g 5.6 5.5 2.4 inch 2 XL / 14.5 14 7 cm / Cup DD / 1200 g 5.7 5.5 2.8 inch 3 XL / 14.5 14 7.5 cm / Cup E / 1400 g 5.7 5.5 3.0 inch 4 XL / 15.5 14.5 8 cm / Cup EE / 1600 g 6.1 5.7 3.1 inch. Product S / M/ L / XL / 2 XL / 3 XL / 4 XL. The underwear is one size, width 29 cm, elastic, suitable for chest circumference 65-95 cm.

Newtech Display PFF B812 BLK 6 PCS Plastic Female Form Big Breasts 1 2 Black Set Of 6 Pieces

Newtech Display PFF B812 BLK 6 PCS Plastic Female Form Big Breasts 1 2 Black Set Of 6 Pieces
Newtech Display PFF B812 BLK 6 PCS Plastic Female Form Big Breasts 1 2 Black Set Of 6 Pieces

Newtech Display PFF B812 BLK 6 PCS Plastic Female Form Big Breasts 1 2 Black Set Of 6 Pieces. 1 / 2 Female Form Big Breasts-Black Plastic Form- Pack of 6 pcs.

Silicone Breast Form Right Left Side Single Shoulder With Adjustable Strap For Prosthesis For Mastectomy Patient 2 900G 5XL 7 9 6 7 3 9Inch Cupf

Silicone Breast Form Right Left Side Single Shoulder With Adjustable Strap For Prosthesis For Mastectomy Patient 2 900G 5XL 7 9 6 7 3 9Inch Cupf
Silicone Breast Form Right Left Side Single Shoulder With Adjustable Strap For Prosthesis For Mastectomy Patient 2 900G 5XL 7 9 6 7 3 9Inch Cupf

Silicone Breast Form Right Left Side Single Shoulder With Adjustable Strap For Prosthesis For Mastectomy Patient 2 900G 5XL 7 9 6 7 3 9Inch Cupf. Advantages: Adjustable, Durable, Washable and Waterproof; Full Silicone Breast Forms Boobs Touch feeling like Real human Breasts. Material: 100% high quality non-allergic medical grade silicone, Skin-friendly, realistic outer skin feel, soft and comfortable, bounce like real breast. Put it in boxes or bags when not used. Function: fake boobs, false silicone breast forms with strap, perfect for women with mastectomy need, you Do Not need to a special pocket bra, also for women with flat chest, cross dresser, crossdressing, transgender, cosplay etc. Clean it in lukewarm water with mild soap and dry it with towel gently, protect from hot temperature. Stay away from things with sharp points, such as scissors, needles, etc. 250 g / S/ 14 12.5 5 cm / 5.5 4.9 2.0 inch / Cup A 300 g / M/ 14.5 12.5 6 cm / 5.7 4.9 2.4 inch / Cup B 400 g / L/ 16 13 7 cm / 6.3 5.1 2.8 C inch / Cup C 500 g / XL / 16.5 14 7.5 cm / 6.5 5.5 3.0 inch / Cup D 600 g / 2 XL / 17.5 15 8.5 cm / 6.9 5.9 3.3 inch / Cup DD 700 g / 3 XL / 18 15.5 9 cm / 7.1 6.1 3.5 inch / Cup E 800 g / 4 XL / 19 16.5 9.5 cm / 7.5 6.5 3.7 inch / Cup EE 900 g / 5 XL / 20 17 10 cm / 7.9 6.7 3.9 inch / Cup F 1000 g / 6 XL / 20 17.5 11 cm / 7.9 6.9 4.3 inch / Cup FF.

Silicone Breast Forms Lifelike Boobs Enhancers Clear Shoulder Straps For Cross Dresser Cosplay 1900G

Silicone Breast Forms Lifelike Boobs Enhancers Clear Shoulder Straps For Cross Dresser Cosplay 1900G
Silicone Breast Forms Lifelike Boobs Enhancers Clear Shoulder Straps For Cross Dresser Cosplay 1900G

Silicone Breast Forms Lifelike Boobs Enhancers Clear Shoulder Straps For Cross Dresser Cosplay 1900G. Keep your body balance, prevent postoperative oblique and scoliosis. Material: 100% non-allergic silicone, Odourless, Skin Friendly. These round shaped breasts forms could protect your bust from physical harm. Cross dresser that want to have fuller side to have better more natural look. made of medical grade pure silicone gel, touch very soft and skin-friendly, the shape designed by professional works ensurethe item can fit you well and wear very comfortableas same as real breasts. Widely Application: Designed as enhancers for women with flat chest or uneven cup size for a fabulous shape, and perfect suitable for crossdresser, transgender, mastectomy patients, Cosplay, custom or just for fun. Authentic Visual: The contour of silicone breast is perfectly round edge which is gives you a ultra-smooth appearance and authentic visual effect. The silicone breast form can perfect used for mastectomypatients to save you a few months of embarrassment and as enhancer for women with flat chest or uneven cup size, ensure you looks morefeminine and sexy, and also suitable for cross dresser, transgender, costume, cos play etc. The silicone enhancers can perfectly boost breasts by 2 6 cups size. Features: High-quality silicone, soft and comfortable. Graceful curve of the body shape, build your confidence.

Silicone Breast Forms Fake Boobs False Breasts For Crossdresser Cosplay Mastectomy Patient

Silicone Breast Forms Fake Boobs False Breasts For Crossdresser Cosplay Mastectomy Patient
Silicone Breast Forms Fake Boobs False Breasts For Crossdresser Cosplay Mastectomy Patient

Silicone Breast Forms Fake Boobs False Breasts For Crossdresser Cosplay Mastectomy Patient. Washable and Waterproof, Conjoined Silicone Breast Forms Boobs Feeling Like Real Human Breasts. Material: silicone. Product Designed as enhancers or prosthesis for women with flat chest (very small or no breasts), It's also perfect for. Fake Breasts Allows You to Go Bra-less with Confidence, Nobody Knows It's Fake Boobs Except Yourself. Form enhancing product creates women's breasts to look fuller with more cleavage.

It Stays Roll On Body Adhesive 2 Fl Oz Clear 1 Pack

It Stays Roll On Body Adhesive 2 Fl Oz Clear 1 Pack
It Stays Roll On Body Adhesive 2 Fl Oz Clear 1 Pack

It Stays Roll On Body Adhesive 2 Fl Oz Clear 1 Pack. it stays roll-on body adhesive - Theatrical make up and devices or anything else you want to stay put! Surgical and orthopedic belts and devices. Roll-on applicator applies with ease, gives complete comfort and flexibility of movement. Odorless and easy to wash off. Men's and women's socks - knee socks, nylons, pantyhose, shoulder straps. is so flexible, you will never know it's there. Not irritating to skin. All products are designed and engineered with your comfort in mind. Support and surgical stockings. Our private line of high quality IT STAYS at value pricing! Just like the big name brands. Theatrical make up and devices or anything else you want to stay put! Is so flexible, you will never know it's there. It Stays will hold up almost much anything that may slip on your skin. Simply apply small amount to skin to hold article in place, for example at the top band of the stocking. It Stays Hypo-allergenic roll-on body adhesive to help stockings stay in place securely and comfortably. Bell-Horn It Stays! It's Your Safe SPOT on a DOT! 2 Pack Dreamlover Wig Hanger, Portable Hanging Wig Stand for All Wigs and Hats, Collapsible Wig Dryer, Durable Wig Stand Tool Holder, Hat and Cap Holder (White). Roll-On Body Adhesive, 2 fl oz. Dreamlover 3 Pack Nude Wig Caps with Thick and Strong Nylon Thread, Durable Mesh Net Fishnet Wig Cap with Close Dome, Perfect for Mermaid Makeup (Natural Nude). Grande Size 32", Diameter. Piece Out Contour Fiber Creme for Synthetic, Heat Friendly and Human Hair. dot 2 dance Portable Marley Dance Floor (32) Double-Sided, Turnboard, Tap Board Beyond. Brittny Professionals Wig Brush Combo. Wig Head Cork Mannequin Canvas Block Head with Stand Set for Wigs Making Display Styling 23 Inch (Cork Head T-Pins Clamp Stand). Beaugee Wig Grip Headband, Bundle with Free Comb - Adjustable Comfort Head Hair Band for Women - Velvet Material - Velcro Closure - Non Slip, Keeps Wig Secured - Prevents Headaches Hair Loss (Beige). Dreamlover 2 Pack Short Wig Stands for Wigs, 14.2 Inches Portable Collapsible Wig Dryer, Durable Wig Holder, Travel Wig Stands (Black). Jon Renau Holding Spray 8.5 oz.

Silicone Breast Forms False Full Boobs Fake Breast Silicone Bust Enhancer For Mastectomy Crossdressing Size 5XL Cup F 2

Silicone Breast Forms False Full Boobs Fake Breast Silicone Bust Enhancer For Mastectomy Crossdressing Size 5XL Cup F 2
Silicone Breast Forms False Full Boobs Fake Breast Silicone Bust Enhancer For Mastectomy Crossdressing Size 5XL Cup F 2

Silicone Breast Forms False Full Boobs Fake Breast Silicone Bust Enhancer For Mastectomy Crossdressing Size 5XL Cup F 2. Easy maintenance: Wash with cold or warm water, needn't special care, then wipe with soft towel, and placed in a cool dry place. Perfectly water drap shaped, which is always fit you to an authentic vision effect, touch very soft and feeling as same as real. Features: Superior quality: medical-grade silicone gel incased in thin but very strong film, not allergies, no odor Scientific design: Slight concave on the back can be more closely fit your chest, making you feel it just like a part of your body. Widely aplication: The breast forms perfect for post mastectomy patients, women with flat chest or unevencup size, crossdresers, trangenders, cosplay, costume party, stage performance etc. (The item does not come with glue) Apply glue to the back of two breast, you just need to daub evenly. Lifelike looking: Realistic shape and nature color provided the item vivid looking. Maintenance and washing is easy in warm water with mild soap. Then, you could touch the breasts to confirm that if sticky reach your effect and stick. Put the breast on the table flatly and take out the glue. How to use: It could be used after making sure the item is in good condition. After daubing evenly and then placed them to a ventilated place to dry more than 30 minutes. Silicone Breast Form Full Boobs Sexy Fake Breast, The silicone enhancers can perfectly boost breasts by 24 cups size, Realistic Feel for Transwomen, Prosthesis Mastectomy Bra Inserts, Transgender Individuals, Crossdressers, Cosplay. Material: 100% Silicone, self-adhesive, Skin Friendly; Size: XXXXXL, Cup F, 18 14 7.5 cm / 7.1 5.5 3 Inch, 1800 g.

Waterdrop Shaped Silicone Breast Forms Straps Adjustable Boobs Lifelike Cup Size Include A H Cup 500 3200G 1 800G L Cupc 9 6 6 3 2 6Inch

Waterdrop Shaped Silicone Breast Forms Straps Adjustable Boobs Lifelike Cup Size Include A H Cup 500 3200G 1 800G L Cupc 9 6 6 3 2 6Inch
Waterdrop Shaped Silicone Breast Forms Straps Adjustable Boobs Lifelike Cup Size Include A H Cup 500 3200G 1 800G L Cupc 9 6 6 3 2 6Inch

Waterdrop Shaped Silicone Breast Forms Straps Adjustable Boobs Lifelike Cup Size Include A H Cup 500 3200G 1 800G L Cupc 9 6 6 3 2 6Inch. Stay away from things with sharp points, such as scissors, needles, etc. Clear silicone back and shoulder straps are already attached to the breast form which gives you the security and freedom for everyday activities. Clean it in lukewarm water with mild soap and dry it with towel gently, protect from hot temperature. Advantages: Adjustable, Durable, Washable and Waterproof; Full Silicone Breast Forms Boobs Touch feeling like Real human Breasts. Put it in boxes or bags when not used. Effect: Silicone Breasts Perfectly For Cross dresser, Transgender, Mastectomy, cosplay etc. 500 g / S/ 24 15 5.5 cm / Cup A / 9.4 5.9 2.2 inch 600 g / M/ 24.3 15.6 6 cm / Cup B / 9.6 6.1 2.4 inch 800 g / L/ 24.5 16 6.5 cm / Cup C / 9.6 6.3 2.6 inch 1000 g / XL / 25 16.2 7 cm / Cup D / 9.8 6.4 2.8 inch 1200 g / 2 XL / 25.5 16.5 8 cm / Cup DD / 10 6.5 3.1 inch 1400 g / 3 XL / 26 16.8 8.5 cm / Cup E / 10.2 6.6 3.3 inch 1600 g / 4 XL / 26 17 8.8 cm / Cup EE / 10.2 6.7 3.5 inch 1800 g / 5 XL / 27 18 9 cm / Cup F / 10.6 7.1 3.5 inch 2000 g / 6 XL / 28 19 9.2 cm / Cup FF / 11 7.5 3.6 inch 2400 g / 7 XL / 30 20 9.5 cm / Cup G / 11.8 7.9 3.7 inch 2800 g / 8 XL / 32 20.5 9.8 cm / Cup GG / 12.6 8.1 3.9 inch 3200 g / 9 XL / 35 21.5 10 cm / Cup H / 13.8 8.5 3.9 inch.

Silicone Breast Forms Lifelike Fake Boobs Enhancer For Mastectomy Crossdressers Cosplay Transgender 2 2000G 6XL Cupff 8 1 6 9 3 5Inch

Silicone Breast Forms Lifelike Fake Boobs Enhancer For Mastectomy Crossdressers Cosplay Transgender 2 2000G 6XL Cupff 8 1 6 9 3 5Inch
Silicone Breast Forms Lifelike Fake Boobs Enhancer For Mastectomy Crossdressers Cosplay Transgender 2 2000G 6XL Cupff 8 1 6 9 3 5Inch

Silicone Breast Forms Lifelike Fake Boobs Enhancer For Mastectomy Crossdressers Cosplay Transgender 2 2000G 6XL Cupff 8 1 6 9 3 5Inch. Authentic Visual: The contour of silicone breast is perfectly waterdrop shaped edge which is gives you a ultra-smooth appearance and authentic visual effect. Widely Application: Designed as enhancers for women with flat chest or uneven cup size for a fabulous shape, and perfect suitable for crossdresser, transgender, mastectomy patients, Cosplay, custom or just for fun. Material: 100% high quality hypoallergenic medical grade silicone Gel, touch very soft and feeling as same as real. 500 g / S/ 14 12.5 4.5 cm / Cup A / 5.5 4.9 1.8 inch 600 g / M/ 15.5 13 5 cm / Cup B / 6.1 5.1 2.0 inch 800 g / L/ 16.5 13.6.5.5 cm / Cup C / 6.5 5.4 2.2 inch 1000 g / XL / 17.5 14.2.6.1 cm / Cup D / 6.9 5.6 2.4 inch 1200 g / 2 XL / 18.2 15.1.6.7 cm / Cup DD / 7.2 5.9 2.6 inch 1400 g / 3 XL / 18.8 15.6.7.5 cm / Cup E / 7.4 6.1 3.0 inch 1600 g / 4 XL / 19.6 16.5.8.2 cm / Cup EE / 7.7 6.5 3.2 inch 1800 g / 5 XL / 20.2 17.2.8.6 cm / Cup F / 8.0 6.8 3.4 inch 2000 g / 6 XL / 20.5 17.5.9 cm / Cup FF / 8.1 6.9 3.5 inch 2400 g / 7 XL / 21 18 10 cm / Cup G / 8.3 7.1 3.9 inch.

1 Pair Silicone Breast Form Mastectomy Postoperative Artificial Boobs For Cosplay Transgender 3XL Cupe 1400G 8 3 5 5 2 8Inch

1 Pair Silicone Breast Form Mastectomy Postoperative Artificial Boobs For Cosplay Transgender 3XL Cupe 1400G 8 3 5 5 2 8Inch
1 Pair Silicone Breast Form Mastectomy Postoperative Artificial Boobs For Cosplay Transgender 3XL Cupe 1400G 8 3 5 5 2 8Inch

1 Pair Silicone Breast Form Mastectomy Postoperative Artificial Boobs For Cosplay Transgender 3XL Cupe 1400G 8 3 5 5 2 8Inch. Authentic Visual: The contour of silicone breast is perfectly waterdrop shaped edge which is gives you a ultra-smooth appearance and authentic visual effect. Medical Silicone Material: 100% high quality hypoallergenic medical grade silicone Gel, soft and comfortable, safe and no side-effects. Widely Application: Designed as enhancers for women with flat chest or uneven cup size for a fabulous shape, and perfect suitable for crossdresser, transgender, mastectomy patients, Cosplay, custom or just for fun. This kind of artificial breast closer to the human breast tissue in the softness, flexibility, proportion and color Touch Real Feeling: So soft like real skin. It feels soft and smooth like tender skin, playing a role in increasing busts and external breast enhancement, so that the chest becomes upright, plump and charming. ALL SIZES: M, Cup B size, 600 g / Pair. Dimensions (L-W-H), 7.1 4.5 2.1 inch / 18 11.5 5.2 cm L, Cup C size, 800 g / Pair. Dimensions (L-W-H), 7.5 4.7 2.2 inch / 19 12 5.5 cm XL, Cup D size, 1000 g / Pair. Dimensions (L-W-H), 7.9 4.9 2.4 inch / 20 12.5 6 cm 2 XL, Cup DD size, 1200 g / Pair. Dimensions (L-W-H), 8.1 5.1 2.6 inch / 20.5 13 6.5 cm 3 XL, Cup E size, 1400 g / Pair. Dimensions (L-W-H), 8.3 5.5 2.8 inch / 21 14 7 cm 4 XL, Cup EE size, 1600 g / Pair. Dimensions (L-W-H), 8.5 5.7 3.0 inch / 21.5 14.5 7.5 cm Medical Silicone Material: 100% high quality hypoallergenic medical grade silicone Gel, soft and comfortable, safe and no side-effects. Size: M / L/ XL / 2 XL / 3 XL / 4 XL, Please refer to the product below for detailed dimensions.

Hypoallergenic Silicone Breasts Forms Triangle Shape For Women Enhancers Flat Chest Mastectomy 1400G 3XL Cupe 7 1 6 1 3 5Inch

Hypoallergenic Silicone Breasts Forms Triangle Shape For Women Enhancers Flat Chest Mastectomy 1400G 3XL Cupe 7 1 6 1 3 5Inch
Hypoallergenic Silicone Breasts Forms Triangle Shape For Women Enhancers Flat Chest Mastectomy 1400G 3XL Cupe 7 1 6 1 3 5Inch

Hypoallergenic Silicone Breasts Forms Triangle Shape For Women Enhancers Flat Chest Mastectomy 1400G 3XL Cupe 7 1 6 1 3 5Inch. The silicone enhancers can perfectly boost breasts by 2 6 cups size. Triangle Shape to match the curves of the chest cage giving perfect fit and comfort. A pair of full silicone breasts, designed as enhancers or prosthesis for women with flat chest (very small or no breasts). Material: 100% high quality hypoallergenic medical grade silicone Gel, touch very soft and feeling as same as real. It's also perfect for post op mastectomy and everybody else who wants an invisible support for a fabulous shape! 500 g / S/ 14 12.5 5 cm / Cup A / 5.5 4.9 2.0 inch 600 g / M/ 14.5 12.5 6 cm / Cup B / 5.7 4.9 2.4 inch 800 g / L/ 16 13 7 cm / Cup C / 6.3 5.1 2.8 inch 1000 g / XL / 16.5 14 7.5 cm / Cup D / 6.5 5.5 3.0 inch 1200 g / 2 XL / 17.5 15 8.5 cm / Cup DD / 6.9 5.9 3.3 inch 1400 g / 3 XL / 18 15.5 9 cm / Cup E / 7.1 6.1 3.5 inch 1600 g / 4 XL / 19 16.5 9.5 cm / Cup EE / 7.5 6.5 3.7 inch 1800 g / 5 XL / 20 17 10 cm / Cup F / 7.9 6.7 3.9 inch 2000 g / 6 XL / 20 17.5 11 cm / Cup FF / 7.9 6.9 4.3 inch.

Water Drop Silicone Breast Forms Natural With Strap For Mastectomy Cross Dresser Breast Cancer Recovery Transgender Cosplay 1 600G M Cupb 10 4 7 1 2 0Inch

Water Drop Silicone Breast Forms Natural With Strap For Mastectomy Cross Dresser Breast Cancer Recovery Transgender Cosplay 1 600G M Cupb 10 4 7 1 2 0Inch
Water Drop Silicone Breast Forms Natural With Strap For Mastectomy Cross Dresser Breast Cancer Recovery Transgender Cosplay 1 600G M Cupb 10 4 7 1 2 0Inch

Water Drop Silicone Breast Forms Natural With Strap For Mastectomy Cross Dresser Breast Cancer Recovery Transgender Cosplay 1 600G M Cupb 10 4 7 1 2 0Inch. Enhance the breast and rebuild your self-confidence. Natural water-drop shape: water-drop shape of these breasts forms most like real breasts, and can be turned vertically or horizontally depending whether you want fullness on the sides or fullness up the chest wall, Enhance the breast and improve your own figure immediately. Material: Made From 100% Medical grade Silicone, very soft and skin friendly, the feeling of touch like real breasts, and gently bounce and jiggle with the body move, looks charming, no one knows you are wearing silicone breast forms. Suitable for Occasions: these breast prosthesis can be used as replacement of breasts for post op mastectomy, and also perfect for cross dresser, breast cancer recovery, transgender, cosplay or everybody else who wants an invisible support for a fabulous shape etc. Maintain: Clean it in lukewarm water with mild soap and dry it with towel gently, Stay away from things with sharp points, and please don't remove the plastic, otherwise the silicone gel may leak. 600 g / M/ 26.5 18 5.2 cm / Cup B / 10.4 7.1 2.0 inch 800 g / L/ 27.5 19 5.5 cm / Cup C / 10.8 7.5 2.2 inch 1000 g / XL / 29 20 6 cm / Cup D / 11.4 7.9 2.4 inch 1200 g / 2 XL / 30 20.5 6.5 cm / Cup DD / 11.8 8.1 2.6 inch 1400 g / 3 XL / 32 21 7 cm / Cup E / 12.6 8.3 2.8 inch 1600 g / 4 XL / 33 21.5 7.5 cm / Cup EE / 13.0 8.5 3.0 inch.

Silicone Breast Forms One Pair Fake Boobs Fake Breast

Silicone Breast Forms One Pair Fake Boobs Fake Breast
Silicone Breast Forms One Pair Fake Boobs Fake Breast

Silicone Breast Forms One Pair Fake Boobs Fake Breast. Mantainence and washing is easy in warm water with mild soap. Ultra soft to touch, quickly regain their shape after fondling and will gently bounce when you move. Product Designed as enhancers or prosthesis for women with flat chest (very small or no breasts), It's also perfect for post op mastectomy and everybody else who wants an invisible support for a fabulous shape! Clean and Maintain: Just wash with lukewarm water, Protect from hot temperature. Realistic outer skin filled with high quality silicone. The Pair warms to body temperature, have realistic European skin colour and raised nipples and are weighted which mimic not only the look but the feel, bounce and movement of real breasts. Material: Soft, Made of 100% medical-grade silicone breast enhancers, drapes like a natural breast and moves naturally with the body. The silicone enhancers can perfectly boost breasts by 2 6 cups size. The breasts can be used for over 100 times. Waterdrop shape to match the curves of the chest cage giving perfect fit and comfort. The backs are slightly concave, making this an excellent fit for flat chest person.

MFGE8 Lactadherin Breast Epithelial Antigen BA46 HMFG MFGM Milk Fat Globule EGF Factor 8 MFG E8 SED1 Lactadherin Short Form Medin PE 129607 PE 100Ul

MFGE8 Lactadherin Breast Epithelial Antigen BA46 HMFG MFGM Milk Fat Globule EGF Factor 8 MFG E8 SED1 Lactadherin Short Form Medin PE 129607 PE 100Ul
MFGE8 Lactadherin Breast Epithelial Antigen BA46 HMFG MFGM Milk Fat Globule EGF Factor 8 MFG E8 SED1 Lactadherin Short Form Medin PE 129607 PE 100Ul

MFGE8 Lactadherin Breast Epithelial Antigen BA46 HMFG MFGM Milk Fat Globule EGF Factor 8 MFG E8 SED1 Lactadherin Short Form Medin PE 129607 PE 100Ul. Purified by Protein A affinity chromatography. Supplied as a liquid in PBS, p H 7.2. Applications: Suitable for use in Western Blot. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPRPRLLAALCGALLCAPSLLVALDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKCVEPLGMENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLELLGC. Other applications not tested. No preservative added. Binds specifically to rotavirus and inhibits its replication. Specific ligand for the alpha-v / beta-3 and alpha-v / beta-5 receptors. Promotes VEGF-dependent neovascularization. Plays an role in the maintenance of intestinal epithelial homeostasis and the promotion of mucosal healing. Also binds to phosphatidylserine-enriched cell surfaces in a receptor-independent manner. Contributes to phagocytic removal of apoptotic cells in many tissues. Zona pellucida-binding protein which may play a role in gamete interaction. Recognizes human MFGE 8.

Newtech Display PFF B812 PICH 6 PCS Plastic Female Form Big Breasts 1 2 Pink Chrome Set Of 6 Pieces

Newtech Display PFF B812 PICH 6 PCS Plastic Female Form Big Breasts 1 2 Pink Chrome Set Of 6 Pieces
Newtech Display PFF B812 PICH 6 PCS Plastic Female Form Big Breasts 1 2 Pink Chrome Set Of 6 Pieces

Newtech Display PFF B812 PICH 6 PCS Plastic Female Form Big Breasts 1 2 Pink Chrome Set Of 6 Pieces. 1 / 2 Female Form Big Breasts -Pink Chrome Plastic Form- Pack of 6 pcs.

1 Pair Self Adhesive Silicone Breast Form Waterdrop Shaped Nude Color Cup Size A KK 6000G 14XL Cupkk 10 4 8 5 5 9Inch

1 Pair Self Adhesive Silicone Breast Form Waterdrop Shaped Nude Color Cup Size A KK 6000G 14XL Cupkk 10 4 8 5 5 9Inch
1 Pair Self Adhesive Silicone Breast Form Waterdrop Shaped Nude Color Cup Size A KK 6000G 14XL Cupkk 10 4 8 5 5 9Inch

1 Pair Self Adhesive Silicone Breast Form Waterdrop Shaped Nude Color Cup Size A KK 6000G 14XL Cupkk 10 4 8 5 5 9Inch. Authentic Visual: The contour of silicone breast is perfectly waterdrop shaped edge which is gives you a ultra-smooth appearance and authentic visual effect. The silicone breasts are self-adhesive so can be used without bras, and they are reusable for a few times. 1 pair silicone breast form. Material: 100% high quality hypoallergenic medical grade silicone Gel, touch very soft and feeling as same as real. 500 g / S/ 16 11.2 4.1 cm / Cup A / 6.3 4.4 1.6 inch 600 g / M/ 16.5 11.6 4.5 cm / Cup B / 6.5 4.6 1.8 inch 800 g / L/ 17.5 12.5 5.1 cm / Cup C / 6.9 4.9 2.0 inch 1000 g / XL / 18.2 13.4 5.6 cm / Cup D / 7.2 5.3 2.2 inch 1200 g / 2 XL / 18.8 14.2 5.9 cm / Cup DD / 7.4 5.6 2.3 inch 1400 g / 3 XL / 19.3 14.6 6.2 cm / Cup E / 7.6 5.7 2.4 inch 1600 g / 4 XL / 20.3 15.2 7.1 cm / Cup EE / 8.0 6.0 2.8 inch 1800 g / 5 XL / 20.4 16.1 8.2 cm / Cup F / 8.0 6.3 3.2 inch 2000 g / 6 XL / 21.2 16.6 9.3 cm / Cup FF / 8.3 6.5 3.7 inch 2400 g / 7 XL / 22.1 17.5 10.2 cm / Cup G / 8.7 6.9 4.0 inch 2800 g / 8 XL / 22.5 18.1 10.8 cm / Cup GG / 8.9 7.1 4.3 inch 3200 g / 9 XL / 23.5 18.8 11.5 cm / Cup H / 9.3 7.4 4.5 inch 3600 g / 10 XL / 24.5 19.5 12.6 cm / Cup HH / 9.6 7.7 5.0 inch 4100 g / 11 XL / 25.1 19.9 13.5 cm / Cup I / 9.9 7.8 5.3 inch 4600 g / 12 XL / 25.5 20.4 14.3 cm / Cup J / 10 8.0 5.6 inch 5000 g / 13 XL / 26 21 14.5 cm / Cup K / 10.2 8.3 5.7 inch 6000 g / 14 XL / 26.5 21.5 15 cm / Cup KK / 10.4 8.5 5.9 inch.

Silicone Breast Forms False Boob For Mastectomy Crossdresser Transgender Cosplay Cup B EE Dark Nude Color L Cupc 800G 7 5 4 7 2 2Inch

Silicone Breast Forms False Boob For Mastectomy Crossdresser Transgender Cosplay Cup B EE Dark Nude Color L Cupc 800G 7 5 4 7 2 2Inch
Silicone Breast Forms False Boob For Mastectomy Crossdresser Transgender Cosplay Cup B EE Dark Nude Color L Cupc 800G 7 5 4 7 2 2Inch

Silicone Breast Forms False Boob For Mastectomy Crossdresser Transgender Cosplay Cup B EE Dark Nude Color L Cupc 800G 7 5 4 7 2 2Inch. It feels soft and smooth like tender skin, playing a role in increasing busts and external breast enhancement, so that the chest becomes upright, plump and charming. This kind of artificial breast closer to the human breast tissue in the softness, flexibility, proportion and color Touch Real Feeling: So soft like real skin. Authentic Visual: The contour of silicone breast is perfectly waterdrop shaped edge which is gives you a ultra-smooth appearance and authentic visual effect. Medical Silicone Material: 100% high quality hypoallergenic medical grade silicone Gel, soft and comfortable, safe and no side-effects. ALL SIZES: M, Cup B size, 600 g / Pair. Widely Application: Designed as enhancers for women with flat chest or uneven cup size for a fabulous shape, and perfect suitable for crossdresser, transgender, mastectomy patients, Cosplay, custom or just for fun. Dimensions (L-W-H), 7.1 4.5 2.1 inch / 18 11.5 5.2 cm L, Cup C size, 800 g / Pair. Dimensions (L-W-H), 7.5 4.7 2.2 inch / 19 12 5.5 cm XL, Cup D size, 1000 g / Pair. Dimensions (L-W-H), 7.9 4.9 2.4 inch / 20 12.5 6 cm 2 XL, Cup DD size, 1200 g / Pair. Dimensions (L-W-H), 8.1 5.1 2.6 inch / 20.5 13 6.5 cm 3 XL, Cup E size, 1400 g / Pair. Dimensions (L-W-H), 8.3 5.5 2.8 inch / 21 14 7 cm 4 XL, Cup EE size, 1600 g / Pair. Dimensions (L-W-H), 8.5 5.7 3.0 inch / 21.5 14.5 7.5 cm Medical Silicone Material: 100% high quality hypoallergenic medical grade silicone Gel, soft and comfortable, safe and no side-effects. Size: M / L/ XL / 2 XL / 3 XL / 4 XL, Please refer to the product below for detailed dimensions.